PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G230400.1.p
Common NameGLYMA_07G230400, LOC100816514
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SRS
Protein Properties Length: 331aa    MW: 35295.6 Da    PI: 7.0258
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G230400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702211.42.2e-651172772154
               DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstkl 91 
                          +sgt +CqdCGnqakkdC+h+RCRtCCksrgfdCathvkstWvpa++rrerq ++ aa++++    +++ +k++r   s+++s +s+++ 
  Glyma.07G230400.1.p 117 GSGTNTCQDCGNQAKKDCSHRRCRTCCKSRGFDCATHVKSTWVPASRRRERQLMTVAAARSSG---DTSGAKKPRLVASQTTSHTSTSNN 203
                          57899**********************************************988887755554...567778888887777777777788 PP

               DUF702  92 ssaeskkeletss..........lPeevsseavfrcvrvssvdd.geeelaYqtavsigGhvfkGiLydqGlee 154
                          ++++++++++t s          lP +v+++avf+cvrv++vdd ge+e+aYq++v+igGhvfkG+LydqG+e+
  Glyma.07G230400.1.p 204 TNTTPPRSFDTGSshqdvgfkesLPCQVRAPAVFKCVRVTAVDDgGEDEYAYQAVVKIGGHVFKGFLYDQGVED 277
                          88888899988888899999999*********************899*************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.2E-60120276IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016239.6E-27122164IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.5E-29227275IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MWPGASRSFN YNMAPHHDIF VVAPASSFHH HHDHNDAVLS DPNNGSNNSN NNPGTALGVN  60
VFPLLTATPC LESEGIMGNI SHHRNRIQLW EDHESSPPQQ QQGHVERDTC GDGGLGGSGT  120
NTCQDCGNQA KKDCSHRRCR TCCKSRGFDC ATHVKSTWVP ASRRRERQLM TVAAARSSGD  180
TSGAKKPRLV ASQTTSHTST SNNTNTTPPR SFDTGSSHQD VGFKESLPCQ VRAPAVFKCV  240
RVTAVDDGGE DEYAYQAVVK IGGHVFKGFL YDQGVEDKEG YPNLSELHLG GGNGVSSSSP  300
MVDPSHDVYA ASGGGLLLGG SSNYGNHPIN *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.422250.0meristem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006583967.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like
RefseqXP_006583968.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like
RefseqXP_006583969.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like
RefseqXP_014633679.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like
SwissprotQ94CK93e-85LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLK7L3E30.0K7L3E3_SOYBN; Uncharacterized protein
STRINGGLYMA07G35780.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Representative plantOGRP13131549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.49e-79Lateral root primordium (LRP) protein-related